Basic Information | |
---|---|
Taxon OID | 3300003375 Open in IMG/M |
Scaffold ID | JGI26470J50227_1046813 Open in IMG/M |
Source Dataset Name | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 772 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Lentic Enriched Actinobacterial Communities From Dystrophic Bog Grosse Fuchskuhle, Brandenburg, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Trout Bog Lake, Wisconsin, USA | |||||||
Coordinates | Lat. (o) | 46.0409 | Long. (o) | -89.686 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010516 | Metagenome | 302 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI26470J50227_10468132 | F010516 | N/A | MNPYAVWVPTNTGHYLLTFATLDDAHLFVIKFGGGLKVIRNTFENF* |
⦗Top⦘ |