NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25909J50240_1003821

Scaffold JGI25909J50240_1003821


Overview

Basic Information
Taxon OID3300003393 Open in IMG/M
Scaffold IDJGI25909J50240_1003821 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3856
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (90.91%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006505Metagenome / Metatranscriptome371Y
F013408Metagenome / Metatranscriptome271Y
F025747Metagenome / Metatranscriptome200Y
F071247Metagenome / Metatranscriptome122Y

Sequences

Protein IDFamilyRBSSequence
JGI25909J50240_10038211F013408N/AVEFLYRKEYDLTEKEHIVVDFTPYKTKAGKIMSHIVLSDKDKNLTRAIVFPSMYKISLAKMREGMKCQVILSTLDDGTLMIKEIK*
JGI25909J50240_100382111F006505GGAMKLADLVKTKANRVLGIDASTNSIAFCLMQNNVPLKWGKVDL
JGI25909J50240_10038214F025747AGGAGGVPNLDEFFKKEKVMASELERFGGKKPCAKCDKDAEEYFWEVATLTMTWTCPDGHENTYRLN*
JGI25909J50240_10038216F071247GGAGGMGSNNKIPFNQTVIKNGRXVRVRKDGSVKADLGPYKTEQTKAKQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.