NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI26532J50257_10013112

Scaffold JGI26532J50257_10013112


Overview

Basic Information
Taxon OID3300003403 Open in IMG/M
Scaffold IDJGI26532J50257_10013112 Open in IMG/M
Source Dataset NameWastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_cont_500_plan
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3149
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Source Dataset Sampling Location
Location NameSouth Africa: Cape Town
CoordinatesLat. (o)-33.927Long. (o)18.452665Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001866Metagenome624Y

Sequences

Protein IDFamilyRBSSequence
JGI26532J50257_100131121F001866GAGMAFVSECLQSPVVEVGDDDSTMVVDAHSSRLVELAWLIAFGAELEQERAIDQRQYLHSIIVGINDNDSVSIIIDRNACWIVELARSRSFVAADLEQEREIDRRQEHQSIAAAIGDDCAMMMLVDRNIVRIDEPEIS*
JGI26532J50257_100131123F001866GAGLQPKVEEVGDDDSTMVVDAQSMRIIELAWLIALRAELEQERAIDRRQYLHSMIEGINGNDSVSIIIDRNACWQVELARSTSFVAADLEQEREIDRRQEHQSMIAAIGDDRAMMMLVDRNIVRIPELEISCSL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.