NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25914J50564_10051815

Scaffold JGI25914J50564_10051815


Overview

Basic Information
Taxon OID3300003429 Open in IMG/M
Scaffold IDJGI25914J50564_10051815 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1104
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001043Metagenome / Metatranscriptome794Y
F019321Metagenome / Metatranscriptome230Y
F104501Metagenome / Metatranscriptome100Y

Sequences

Protein IDFamilyRBSSequence
JGI25914J50564_100518151F019321N/AIDAVKDIITEAYGDSEDQETLRSIAEALDIALTRTVEWSATIEVSGTIDLDLLADYDTDVESEIYDNLTVDTNNGNIEVIDQEVTNVREN*
JGI25914J50564_100518153F001043N/AMNQQDTQGDKMSDYKDGFDDGYKFAREEIMEKLAEIDIADIDSWILDRLSEMIEGGNL*
JGI25914J50564_100518155F104501GGCGGMGDRANFGFKDRKGDTVFLYGHWAGHRMLENLADAVSAAEPRWGDEEYATRIAISHLVGDEWKSETGWGISINRLADNEHKVPIINWAAKTFTLMEE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.