Scaffold JGI20214J51088_10517281

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI20214J51088_10517281

Scaffold JGI20214J51088_10517281

Overview

Basic Information
Taxon OID	3300003432 Open in IMG/M
Scaffold ID	JGI20214J51088_10517281 Open in IMG/M
Source Dataset Name	Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	766
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location
Location Name	Sacramento, California, United States
Coordinates	Lat. (^o)	38.1072	Long. (^o)	-121.6485	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F106197	Metagenome / Metatranscriptome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20214J51088_105172812	F106197	GGTGG	MKKVLLCVLLLLLWICVDCVSADTISAQIDSFDFPSGDWYRGSDQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYADPGSSTYFVNPVWHIPDDAELGSYQADFYLYSYYDSRTGELSEQLDQVDLVGAFSVVG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.