Scaffold ERB454_1024611

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold ERB454_1024611

Scaffold ERB454_1024611

Overview

Basic Information
Taxon OID	3300003442 Open in IMG/M
Scaffold ID	ERB454_1024611 Open in IMG/M
Source Dataset Name	Combined Assembly of Gp0111447, Gp0111475, Gp0111489
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of California, Los Angeles, University of Waikato
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	755
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Volcanic → Fumaroles → Unclassified → Volcano-Associated Fumarole Sediment → Volcano-Associated Fumarole Microbial Communities From Mt. Erebus, Antarctica, That Are Thermophilic

Source Dataset Sampling Location
Location Name	Mt. Erebus, Antarctica
Coordinates	Lat. (^o)	-77.533333	Long. (^o)	167.116667	Alt. (m)		Depth (m)	0 to .04
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042051	Metagenome / Metatranscriptome	159	Y

Sequences

Protein ID	Family	RBS	Sequence
ERB454_10246111	F042051	AGGAG	MTTFGEISWNDDVFVGSDNGKKNNNKDLFLRLEEGSNEMRLVTQPYQYLVHKFKKDPNNPRDFGQKVGCSSIHGSCPLCADGEKAKPRWLIGVISRKSGTYKILDISFAVFSQIRKLARNTQRWGDPTKYDIDIVVDKNGGATGYYSVQPISKEPLSAADQKIKDDADLEDLKRRVTPLTPDQVQKRIDRIMSLGDAASAATAPAT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.