Scaffold P52013CM_1004337

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold P52013CM_1004337

Scaffold P52013CM_1004337

Overview

Basic Information
Taxon OID	3300003465 Open in IMG/M
Scaffold ID	P52013CM_1004337 Open in IMG/M
Source Dataset Name	Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P5 sample
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Campinas
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	13550
Total Scaffold Genes	14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (71.43%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil → Ore Pile And Mine Drainage Contaminated Soil Microbial Communities From Mina Do Sossego, Brazil, In A Copper Mine

Source Dataset Sampling Location
Location Name	Mina do Sossego, Brazil
Coordinates	Lat. (^o)	-6.426389	Long. (^o)	-50.051389	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033513	Metagenome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
P52013CM_100433712	F033513	AGGAGG	MSNLNEIKERHGRDRWKDAGFIAAALLLTALAIGSVTSKAAGTPGQSQYSGRDHVTVFESNVEIQR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.