NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold NAP2_1110589

Scaffold NAP2_1110589


Overview

Basic Information
Taxon OID3300003476 Open in IMG/M
Scaffold IDNAP2_1110589 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)607
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine → Estuary Microbial Community From Gulf Of Naples, Italy

Source Dataset Sampling Location
Location NameGulf of Naples
CoordinatesLat. (o)40.725Long. (o)14.39983Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043493Metagenome / Metatranscriptome156Y

Sequences

Protein IDFamilyRBSSequence
NAP2_11105892F043493N/AMAKNITAVNKSGGDGVIIATNGVTRIVAIHAYSTIAGTFAIADSTGDKIKFQVPASGTADIYIGDMGVRCDATVSVSTPNSGSVTLFVG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.