NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25924J51412_1001435

Scaffold JGI25924J51412_1001435


Overview

Basic Information
Taxon OID3300003491 Open in IMG/M
Scaffold IDJGI25924J51412_1001435 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4403
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (16.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Fulvivirgaceae → Fulvivirga → Fulvivirga aurantia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025232Metagenome / Metatranscriptome202Y
F028461Metagenome191N

Sequences

Protein IDFamilyRBSSequence
JGI25924J51412_100143511F028461N/AMRKKTNAATYYKNPSLQESIIRYYKEKQLNFVVKHSNYNTQIIGSEATLKFIQTEHPIRVFVAYNKIVKDLKESPKTVEILQGEWSTDNFDSRNGLKPAFYKKILNLDISSAYPYCLWINKLITQDTFNYLMAMPKTERLPAIGMIAKKSVWITYTAGKADSWELKEGFYANIFFYVIQQITDLMAWAAEIAGDSFLFYWVDGIFLKPSIPKKKLDEITRIFSEQGYYFKYEKVENCNIVRDGDKLLINMIKNGQEKPYQMYDKNLARNFTKVLQQLENA*
JGI25924J51412_10014354F025232N/AMENVNEKILEDYRLLITRLDLMKAELDEVNRANFKLRKAFNELLDIYQEELXRRESTEDSQTVAYYWCDKAGILD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.