Scaffold JGIcombinedJ51221_10001157

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGIcombinedJ51221_10001157

Scaffold JGIcombinedJ51221_10001157

Overview

Basic Information
Taxon OID	3300003505 Open in IMG/M
Scaffold ID	JGIcombinedJ51221_10001157 Open in IMG/M
Source Dataset Name	Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6546
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Source Dataset Sampling Location
Location Name	Harvard Forest LTER, Petersham, MA, USA
Coordinates	Lat. (^o)	42.53312	Long. (^o)	-72.189707	Alt. (m)		Depth (m)	0 to .1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002012	Metagenome / Metatranscriptome	604	Y

Sequences

Protein ID	Family	RBS	Sequence
JGIcombinedJ51221_100011576	F002012	N/A	MALSSTTWMISGLARTTRAALSLHTLLRAQPALFASLMLLQRHSSRRDDVYNILWAIVFGFATLNILSLAARRFEPNRRGLTFGELMAVLVVLLSIFLLGWELLGVFRIFPIKLQR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.