Basic Information | |
---|---|
Taxon OID | 3300003607 Open in IMG/M |
Scaffold ID | JGI20129J51889_1002195 Open in IMG/M |
Source Dataset Name | Hypoxic/sulfidic aquatic microbial communities from Monarch Geyser, Yellowstone National Park, USA - MG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2852 |
Total Scaffold Genes | 8 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (37.50%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Hypoxic/Sulfidic Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Monarch Geyser, Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.376 | Long. (o) | -110.69 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F076264 | Metagenome / Metatranscriptome | 118 | Y |
F087445 | Metagenome / Metatranscriptome | 110 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI20129J51889_10021953 | F076264 | GAG | MSAISSAIQNMVNGLQNLFVALIDVFGNAINAIGNTLASLANPIGYLVGVLAVFGSLIGIIYYVFRGRGGVSGLVGGIKSFFTSFF* |
JGI20129J51889_10021955 | F087445 | N/A | MSASSVKPGDELIQRLLNMSEYDLKRVFKMLPIDKRLMLALDTIQEYQNLRSKFDNLFNAFAMNSPKVKEVMENAKKNRKPLDRLADMFMDLMETMLKSKAMTLTDEDREKLREKVREMIESEE* |
⦗Top⦘ |