NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI26082J51739_10075065

Scaffold JGI26082J51739_10075065


Overview

Basic Information
Taxon OID3300003617 Open in IMG/M
Scaffold IDJGI26082J51739_10075065 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)929
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041071Metagenome / Metatranscriptome160N

Sequences

Protein IDFamilyRBSSequence
JGI26082J51739_100750652F041071AGGMSEWTSDTMETKSIALATTALIDSGLVSESKADALATHLSKGAKNWCIKQMKPSNVNENQKVIQKFNSKIWTEYLAKKNYIFDVTDSGVVKRKTSLVEKQERLLEIQNKMVGETFTPPIKKVNKRLLVQARLNRLLTLVKKDIDEMENEMKGLSMINQKLERYFIRRPSFKPKIFIGQEEEYLDLPDIPKRKRILKRLLHLLNMKRFGKMEKIHEKLTQVRRDTMTKLVQIQRDIFINSKECWVRAERASVLDKKHAND
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.