NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold metazooDRAFT_1402029

Scaffold metazooDRAFT_1402029


Overview

Basic Information
Taxon OID3300003647 Open in IMG/M
Scaffold IDmetazooDRAFT_1402029 Open in IMG/M
Source Dataset NameCompost microbial communities from Sao Paulo Zoo, Brazil - ZC4 day 78
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Sao Paulo, Virginia Bioinformatics Institute
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)503
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Source Dataset Sampling Location
Location NameSao Paulo Zoo, Brazil
CoordinatesLat. (o)-23.651072Long. (o)-46.620675Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012882Metagenome / Metatranscriptome276Y

Sequences

Protein IDFamilyRBSSequence
metazooDRAFT_14020291F012882N/AQDSLDALRKATETSYFKAPDAVWVKLVIPTAPKGVGRDEFGPLESQTSIVVRR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.