Scaffold JGI25404J52841_10004471

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI25404J52841_10004471

Scaffold JGI25404J52841_10004471

Overview

Basic Information
Taxon OID	3300003659 Open in IMG/M
Scaffold ID	JGI25404J52841_10004471 Open in IMG/M
Source Dataset Name	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2835
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere → Tabebuia Heterophylla Rhizosphere Microbial Communities From The University Of Puerto Rico

Source Dataset Sampling Location
Location Name	University of Puerto Rico, San Juan, Puerto Rico
Coordinates	Lat. (^o)	18.402889	Long. (^o)	-66.050054	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048012	Metagenome / Metatranscriptome	149	N

Sequences

Protein ID	Family	RBS	Sequence
JGI25404J52841_100044714	F048012	GAG	MDDVVEFDFEVPQCSHCGVSLLTRDQPQASLVVAPDGCVLHWFCAYPPGPTAEHGPPGLPSCPSCHEHLDVGW*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.