Scaffold Ga0008456_1049930

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0008456_1049930

Scaffold Ga0008456_1049930

Overview

Basic Information
Taxon OID	3300003682 Open in IMG/M
Scaffold ID	Ga0008456_1049930 Open in IMG/M
Source Dataset Name	Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_03_M0_10 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	969
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location Name	Monterey Bay, California, USA
Coordinates	Lat. (^o)	36.25	Long. (^o)	-122.2099	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064747	Metatranscriptome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0008456_10499301	F064747	N/A	GRALRNQNPETSSVMDTEEIKQTLLGEIEHNFASVGKRGRLARLESALKPLFDSLPKNEHGNLGHSPVRYALHRIFVQRHGWYIKGLEPDGEGWNNTSPAGVLKDRASSYVEELFEERLGGRGFNLHDTAVLAATLEHIIHDESKSRLTKAYEAKQIAFSDELTRAQADAVLDEYMKLHLLSEETASKVSDRDMTQIFPGWTETQQFVRDIRSEIERTTSVGTLSFSAMTSVVEEVGERFGHFQDAECGAMKATLISMGDGGIGRVPLADFYKTSLNGDTFEFQESEGYLRELGALDTTDPLHPSVIIPNYIQSATNCIASE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.