NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0061020_1045790

Scaffold Ga0061020_1045790


Overview

Basic Information
Taxon OID3300003688 Open in IMG/M
Scaffold IDGa0061020_1045790 Open in IMG/M
Source Dataset NameCoassembly of YNP Bryant MS undermat 2012 and YNP Bryant MS upper layer 2012
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1084
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.534Long. (o)-110.7978Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005028Metagenome / Metatranscriptome414Y
F032180Metagenome / Metatranscriptome180Y
F085751Metagenome / Metatranscriptome111N

Sequences

Protein IDFamilyRBSSequence
Ga0061020_10457901F005028N/ARAAMSFFAARLRGAELDETRLLRWTRHKLRSDARAVAELMLTVGYRPTFIRYFLRYHIPALRESAAVGERYIDPGAAPEARLGLCWRLDDAVLTVYTDLHAAAKRLKQPYRDLAAVXLRWGXVHETVVQLLAKTLERKAKDVVED*
Ga0061020_10457902F032180AGGAMWWKIDPIPHQELEEWERAVGRFERAAKRDVAVRAAGVFVIYELDGVLGYVAGREAPDGAYLVERWVRGKRGWTLYE*
Ga0061020_10457903F085751AGGGGGMNDLIAWLIAGGVIFALVNSNVADGLLSALDLSDNLKRAADWARGVRGLPAGVAAVCFFAMAYVFGALAWRYDLVPTWRFMQPIAADVLATGADWLTFFVVFLTLLPTLIEIATAKLAQRDIPMLRWMVYFFIFFDLVTDHAEAV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.