NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold PicViral_1007261

Scaffold PicViral_1007261


Overview

Basic Information
Taxon OID3300003690 Open in IMG/M
Scaffold IDPicViral_1007261 Open in IMG/M
Source Dataset NameHydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Viral/microbial metagenome assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3022
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Marine, Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Mid Cayman Rise - Piccard2013-Plume

Source Dataset Sampling Location
Location NameMid-Cayman Rise, Caribbean Sea
CoordinatesLat. (o)53.0Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001136Metagenome / Metatranscriptome767Y
F012032Metagenome / Metatranscriptome284Y
F016013Metagenome250Y

Sequences

Protein IDFamilyRBSSequence
PicViral_10072612F012032AGGMTKQQFKTKVGMGFFSCKWLKNNGQVAKIKRGILGQYAWRFTHDPIANRDNFQEHNDYVLAFRVGSGLLPEHSRWASINPNTVFDINRVAV*
PicViral_10072613F016013AGGMTKDIVPIKSVNAVDISPLLREVIEYTKDQNAVGDLETLISKVPSKDSLDWKLISGVLCNAIIEWIAKDTSNRKDLLVHLQSEVGYLLQRMGLTM*
PicViral_10072616F001136GGAGMVVDDTIAQALNRIADGQDEINDTLKRIANHYDGVVPVMTRNANRAEAQGKAIDEEVNNSFGQQVRDIFRPQEN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.