NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0004769_103322

Scaffold Ga0004769_103322


Overview

Basic Information
Taxon OID3300003724 Open in IMG/M
Scaffold IDGa0004769_103322 Open in IMG/M
Source Dataset NameSoil microbial communities from Colorado Plateau and Sonoran desert - Soil Crust after wet up 2B (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)592
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera → Nitrososphaera sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert

Source Dataset Sampling Location
Location NameColorado Plateau and Sonoran desert
CoordinatesLat. (o)38.42Long. (o)-109.4099Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001042Metagenome / Metatranscriptome794Y

Sequences

Protein IDFamilyRBSSequence
Ga0004769_1033221F001042N/AIKLMTTSHLIGKNFASNVPKNFEADADDTIVIDKLLVNKLTELLITSIYSVHTSRRCEIFLTSLDMHLAQYSISNKNDTACREFTEKSSLLLESYQEDVPKSLGKAESCLGEAIDLINLIVSASEAEVNNNG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.