NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0040879_100218

Scaffold Ga0040879_100218


Overview

Basic Information
Taxon OID3300003730 Open in IMG/M
Scaffold IDGa0040879_100218 Open in IMG/M
Source Dataset NameThermal spring microbial communities from Beowulf Spring, Yellowstone National Park, Wyoming, USA - Beowulf (BE_D) (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2277
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027904Metagenome / Metatranscriptome193N
F067921Metagenome / Metatranscriptome125N

Sequences

Protein IDFamilyRBSSequence
Ga0040879_1002183F067921GGGGGMYFERINDKILRNGQYLLLSYSGAKNPLQAMFTGFRVVKHNVTTLYYNFATQVPNFLPMAPYGTSPGPTNSPYYIDNFSFSLQQVKNVTDMFKITNTGDAYQVFYGISPSYLRVVNKIQQQFVSVLEQNIYPSPSFVEMGIDGFQSPLNNPSEKTEFIVFVNLTYNVTLMNTATIPIMPAFNFVINRMTLEPLDQEELKKAILAGFPIRSLGAVDSSIMISPDNYPGLITLSYKEIYGG*
Ga0040879_1002184F027904GGTGGMEKYNPPEYDLFNLNNGSTLVGTSPVTLLYEGQPNAAVIVPPDLTLRVKQVIIQNTTSSVITVQLQAVTTQTGLPSPVNKTPPIPVPANSAVTLDEDEWSINVKTGYSLAAVSSAANSANVFVKAYFVKGTGSPI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.