NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0007811_1001386

Scaffold Ga0007811_1001386


Overview

Basic Information
Taxon OID3300003787 Open in IMG/M
Scaffold IDGa0007811_1001386 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3491
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (90.91%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000652Metagenome / Metatranscriptome959Y
F005705Metagenome / Metatranscriptome392Y
F013757Metagenome / Metatranscriptome268Y

Sequences

Protein IDFamilyRBSSequence
Ga0007811_100138610F013757AGGAGMLTNCVAKAKLVFNKKLQSYKLVVAFNAHKTIKKVGNTEVIKYNFPTQSKCAYVSGDLLAENLSVELAKVLPNVYKTIRTXSVEFVE*
Ga0007811_10013863F005705AGGAGMKIVIKVPKQVRAHIVLFCKDTPFKPKRVENKLAYKRKPKHKGRDYE*
Ga0007811_10013865F000652AGGAGMKKVKVETLIVQELEVPEDWGREEVYDFLAEFQSFRTAFQGVSNEDQTARIVDLGVLTEEVTELGDEAYDD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.