NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0007877_1000797

Scaffold Ga0007877_1000797


Overview

Basic Information
Taxon OID3300003814 Open in IMG/M
Scaffold IDGa0007877_1000797 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6082
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051643Metagenome / Metatranscriptome143N
F104306Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0007877_10007975F051643GGCGGMSRSTVRSQFISYLEGADIPFLSKVMTFPAKFTPEGEFYQGEDPGHQXGCIVFPYIENQSEXRIELTGPTGGGKXITYEVVFTCIFRSNKRKTEDAGTDAETFLDGFTNAIRASKNCGGNGPIFQWGEGGTSGGSDIEVTSYYPRQINGAASATQVVSTVRVRIIEITNSNSYVS*
Ga0007877_10007977F104306AGGAMAGPFLTANSYLGMVIETTEGTLPTSGTSYWLPVTTPQXTPNQMFLRDEALRGSPTTVYDQVXAVRHDEFEFKTFLFADTFPVLLRSILGGTDTKTGSGPYSHTIKVLNSPSTGSQPPTYSILDFDGANYFTVTGAQADTLGLTFGADAAAEATVKYMGNPYTSYTSAPTVFATQSLSAEHLIPAWNTVVSIGGTTYTNVST
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.