Scaffold Ga0063294_10656612

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0063294_10656612

Scaffold Ga0063294_10656612

Overview

Basic Information
Taxon OID	3300003885 Open in IMG/M
Scaffold ID	Ga0063294_10656612 Open in IMG/M
Source Dataset Name	Black smoker hydrothermal vent sediment microbial communities from the Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean - Sample 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	621
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vents → Black Smoker Hydrothermal Vent Sediment Microbial Communities From The Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean

Source Dataset Sampling Location
Location Name	Mid-Atlantic Ridge, South Atlantic Ocean
Coordinates	Lat. (^o)	-15.160005	Long. (^o)	-13.350021	Alt. (m)		Depth (m)	2770
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062887	Metagenome / Metatranscriptome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063294_106566121	F062887	AGGAG	MPVIKTKGGAKYGKGGKLYKGKGAVSRAKRQGRAIEASKHRKKKM*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.