Basic Information | |
---|---|
Taxon OID | 3300003891 Open in IMG/M |
Scaffold ID | Ga0063011_10001716 Open in IMG/M |
Source Dataset Name | Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing sample CP Core 1 1cm |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Wisconsin, Madison |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2484 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediments → Hot Spring Sediment Microbial Communities From Chocolate Pots, Yellowstone National Park, Wyoming That Are Fe(Iii) Reducing |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.427936 | Long. (o) | -110.588466 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F073072 | Metagenome | 120 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0063011_100017162 | F073072 | GAGG | MKKVVFIYARLVEDSEAYEGKTNADIEKEILEDMGLIPYVANIEKVTVLDCH* |
⦗Top⦘ |