Scaffold Ga0063241_1010798

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0063241_1010798

Scaffold Ga0063241_1010798

Overview

Basic Information
Taxon OID	3300003894 Open in IMG/M
Scaffold ID	Ga0063241_1010798 Open in IMG/M
Source Dataset Name	Marine microbial communities from the northern Gulf of Mexico hypoxic zone - Cultivation independent assessment
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Argonne National Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5309
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Hydrothermae → unclassified candidate division EM 3 → Candidatus Hydrothermae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Microbial Communities From The Northern Gulf Of Mexico Hypoxic Zone

Source Dataset Sampling Location
Location Name	northern Gulf of Mexico, LA
Coordinates	Lat. (^o)	28.7167	Long. (^o)	-90.8333	Alt. (m)		Depth (m)	16
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001066	Metagenome / Metatranscriptome	788	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063241_10107983	F001066	N/A	MDEKDNIFTIKPIGNKVDVVEDKRKTISPHNSAKHFKDANLPALCNQCAYRSVEAGGNGKCPKYEEDAVCTIRKDFVAFINQMDTRNPEDLKEMIDMVAKLTFENVLMALTQAKFNENIPDRNTKSEINTLLNIVKTMNDLNSKITVTEKKEFTKEGDVANIFRQIKASKSDG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.