NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063241_1010798

Scaffold Ga0063241_1010798


Overview

Basic Information
Taxon OID3300003894 Open in IMG/M
Scaffold IDGa0063241_1010798 Open in IMG/M
Source Dataset NameMarine microbial communities from the northern Gulf of Mexico hypoxic zone - Cultivation independent assessment
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterArgonne National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5309
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Hydrothermae → unclassified candidate division EM 3 → Candidatus Hydrothermae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Microbial Communities From The Northern Gulf Of Mexico Hypoxic Zone

Source Dataset Sampling Location
Location Namenorthern Gulf of Mexico, LA
CoordinatesLat. (o)28.7167Long. (o)-90.8333Alt. (m)Depth (m)16
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001066Metagenome / Metatranscriptome788Y

Sequences

Protein IDFamilyRBSSequence
Ga0063241_10107983F001066N/AMDEKDNIFTIKPIGNKVDVVEDKRKTISPHNSAKHFKDANLPALCNQCAYRSVEAGGNGKCPKYEEDAVCTIRKDFVAFINQMDTRNPEDLKEMIDMVAKLTFENVLMALTQAKFNENIPDRNTKSEINTLLNIVKTMNDLNSKITVTEKKEFTKEGDVANIFRQIKASKSDG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.