Scaffold Ga0063241_1016088

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0063241_1016088

Scaffold Ga0063241_1016088

Overview

Basic Information
Taxon OID	3300003894 Open in IMG/M
Scaffold ID	Ga0063241_1016088 Open in IMG/M
Source Dataset Name	Marine microbial communities from the northern Gulf of Mexico hypoxic zone - Cultivation independent assessment
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Argonne National Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4128
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (63.64%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Microbial Communities From The Northern Gulf Of Mexico Hypoxic Zone

Source Dataset Sampling Location
Location Name	northern Gulf of Mexico, LA
Coordinates	Lat. (^o)	28.7167	Long. (^o)	-90.8333	Alt. (m)		Depth (m)	16
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100985	Metagenome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063241_10160888	F100985	AGGAG	MEALYAGLSAWAIEIGIAILAFYLLYREEQKVYKRRAAKKEKV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.