Basic Information | |
---|---|
Taxon OID | 3300003938 Open in IMG/M |
Scaffold ID | Ga0063230_11935914 Open in IMG/M |
Source Dataset Name | Wetland microbial communities from Twitchell Island in the Sacramento Delta, California, USA - surface sediment Aug2011 Site C1 Bulk Metatranscriptome (Metagenome Metatranscriptome) (version 2) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4137 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes → Norzivirales | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | California, United States | |||||||
Coordinates | Lat. (o) | 38.1075 | Long. (o) | -121.6497 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F055349 | Metagenome / Metatranscriptome | 138 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0063230_119359142 | F055349 | GGAG | MLTISSPVTGGAQTGLTSPTYTLVADKPPAGTVGYQYAVSAIGGTQTGVDTSSSPSKPFTITTKRPSVLRTLSAVDPVTGVLRSVPRNTYEIRTRKGVIPLAGQAAVPMQIVTTIEVPAGADTADAPNVRAALSLHNGAIAQISAEMGNTAVTGVA* |
⦗Top⦘ |