Scaffold Ga0064068_110284

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0064068_110284

Scaffold Ga0064068_110284

Overview

Basic Information
Taxon OID	3300003962 Open in IMG/M
Scaffold ID	Ga0064068_110284 Open in IMG/M
Source Dataset Name	Activated sludge microbial communities from Ingolstadt, Germany, from a nitrification basin
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Aalborg University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	789
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater → Activated Sludge Microbial Communities From Ingolstadt, Germany, From A Nitrification Basin

Source Dataset Sampling Location
Location Name	Ingolstadt, Germany
Coordinates	Lat. (^o)	48.7	Long. (^o)	11.42	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024268	Metagenome / Metatranscriptome	206	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0064068_1102841	F024268	GGAGG	MAITELYSGTEAVGTTEHSCTTDTAGPDVDTTDGVFQVFLDVSDMIAGDQLQIRIYEKVRSADTQRIVYEAILTGPQIHPIWVSPSLVLMHGWDVTLDALAGTITVNWSIRQVT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.