NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0064067_1006112

Scaffold Ga0064067_1006112


Overview

Basic Information
Taxon OID3300003972 Open in IMG/M
Scaffold IDGa0064067_1006112 Open in IMG/M
Source Dataset NameComposted filter cake microbial communities from Nova Europa, Brazil, from a cane sugar milling plant
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSao Paulo State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)19139
Total Scaffold Genes22 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)18 (81.82%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Filter Cake Produced In Cane Sugar Milling Plant → Composted Filter Cake Microbial Communities From Nova Europa, Brazil, From A Cane Sugar Milling Plant

Source Dataset Sampling Location
Location NameNova Europa, Brazil
CoordinatesLat. (o)-21.818963Long. (o)-48.614275Alt. (m)Depth (m).2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044018Metagenome / Metatranscriptome155Y

Sequences

Protein IDFamilyRBSSequence
Ga0064067_100611218F044018AGGAGMFAISRTTQNAVCMILSAVIVSISLSLGALAAERAAHDGYTVTITQLQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.