Scaffold Ga0063454_100372259

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0063454_100372259

Scaffold Ga0063454_100372259

Overview

Basic Information
Taxon OID	3300004081 Open in IMG/M
Scaffold ID	Ga0063454_100372259 Open in IMG/M
Source Dataset Name	Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	939
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Mediterranean Grasslands, California

Source Dataset Sampling Location
Location Name	Hopland, California
Coordinates	Lat. (^o)	38.99297339	Long. (^o)	-123.0674491	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035045	Metagenome	173	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063454_1003722593	F035045	N/A	MADATFGTFFAEAIEVLEDGISGTVIITDEKGNIVDTFTGTAAEFQASGEWCLLEG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.