NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066191_10022595

Scaffold Ga0066191_10022595


Overview

Basic Information
Taxon OID3300004086 Open in IMG/M
Scaffold IDGa0066191_10022595 Open in IMG/M
Source Dataset NameMarine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius tantulus BELIZE.2 (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1749
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameGermany: Marburg
CoordinatesLat. (o)50.8Long. (o)8.81Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049416Metagenome146Y

Sequences

Protein IDFamilyRBSSequence
Ga0066191_100225951F049416N/AVTNEISTVGGVLGVTSVDDELFVLLGQDNNQVAVYSINDYQLLRHLDLPGLKPHFFNDMTSCVRHKCLYMSECANRCIHRYDLPSSAVSKWPIPYKACGLSVTPSCNLLLTCRVESRGEPNKLIELSSDSGQCVREIALPADIVCPWHGVQLTTGQFVVGHGHSTNSLQRLCVVGDDGKVTRSYGDKRGCDVGQLNYPRHLAVDNDSQFISVADQFNNRVVLLSSTLEFVRYVSEGLSDPHRLHLHQATQRLFIGHWSGDVTVIQL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.