NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0062387_100072990

Scaffold Ga0062387_100072990


Overview

Basic Information
Taxon OID3300004091 Open in IMG/M
Scaffold IDGa0062387_100072990 Open in IMG/M
Source Dataset NameCoassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1745
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada

Source Dataset Sampling Location
Location NameCalvert Island, British Columbia, Canada
CoordinatesLat. (o)51.62Long. (o)-128.09Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013689Metagenome / Metatranscriptome269Y

Sequences

Protein IDFamilyRBSSequence
Ga0062387_1000729903F013689GGAGGMKSAFFTVLLLVGAAQAQHNFLSSNPLPSAPSAQKFWNLENKIDFSILAGQITVDAITTQQGLSNGFRETNPVMRPLVTRGVAGEAAASALGFGFGVGTAYLLHRTHHYKAERIATRTMVAVEGGFVANNLMRLY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.