Basic Information | |
---|---|
Taxon OID | 3300004092 Open in IMG/M |
Scaffold ID | Ga0062389_100024571 Open in IMG/M |
Source Dataset Name | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4346 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Calvert Island, British Columbia, Canada | |||||||
Coordinates | Lat. (o) | 51.62 | Long. (o) | -128.09 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F031571 | Metagenome / Metatranscriptome | 182 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0062389_1000245714 | F031571 | N/A | ISCAEMLMHSVIGTADMGKSQGVRALVTQMTGAFSPVMIGYILALSGGGFVGAFAVLSIAVVISAGCMIALTREGF* |
⦗Top⦘ |