NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066177_10055504

Scaffold Ga0066177_10055504


Overview

Basic Information
Taxon OID3300004096 Open in IMG/M
Scaffold IDGa0066177_10055504 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1415
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000311Metagenome / Metatranscriptome1326Y
F001043Metagenome / Metatranscriptome794Y
F036238Metagenome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0066177_100555041F000311AGGAGMYFELTAPDRLSMEMAYWDAQILGLDPEAMTPLTFNIGTGSIEKVSRIRDKYNLTESYWSDKEATGY*
Ga0066177_100555042F001043AGGAGMSDYKDGFQDGYKFAREEIMEKLAEIDITDIDSWILDRLSEMIEGGTL*
Ga0066177_100555044F036238GGCGGMGDRANFGFRQSNGETIVLYGHWAGHQMLSNLADAIAVAEPRWTDESYATRIAISQLVGKEWTSETGWGLSVNRILDNEHKIPIIDWENKTFSLHEEAPWSEDGNNFKVHGMQDEPIFTMTLENFVSKYSSQLSMV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.