NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0062386_100734771

Scaffold Ga0062386_100734771


Overview

Basic Information
Taxon OID3300004152 Open in IMG/M
Scaffold IDGa0062386_100734771 Open in IMG/M
Source Dataset NameCoassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)811
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada

Source Dataset Sampling Location
Location NameCalvert Island, British Columbia, Canada
CoordinatesLat. (o)51.62Long. (o)-128.09Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001432Metagenome / Metatranscriptome696Y
F017529Metagenome / Metatranscriptome240Y

Sequences

Protein IDFamilyRBSSequence
Ga0062386_1007347711F017529GAGGMPSSSPTEKIECPLCAGTGELTRAEILDRLGVKDFARVAQLSAEEAFRLLQSKHDREHQTAWSRFETELTKRT
Ga0062386_1007347712F001432GGAGMLKKDYIRDGKNRIIASVTNGFDDTTAVTRDEHNKITGRTNDRFHTTRDEHGKLVSINSADPGLLIRKK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.