NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063455_100000005

Scaffold Ga0063455_100000005


Overview

Basic Information
Taxon OID3300004153 Open in IMG/M
Scaffold IDGa0063455_100000005 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from Hopland, California, USA (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)19850
Total Scaffold Genes23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (52.17%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Mediterranean Grasslands, California

Source Dataset Sampling Location
Location NameUSA: Hopland, California
CoordinatesLat. (o)38.99297339Long. (o)-123.0674491Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004222Metagenome / Metatranscriptome448Y
F059284Metagenome / Metatranscriptome134Y

Sequences

Protein IDFamilyRBSSequence
Ga0063455_10000000519F004222N/AMFKKLQVALIRKFARKRLGKDIAPLQTIATHPDVLIPYAKFSMALDKTNLVPAKLKVLGQIRAAKLVECPF*
Ga0063455_1000000054F059284GAGGMKYPSLHIPKISLAVVAFALCVSLQASAACPEPASGHMAICQPSANSTIYQVPHIEVTANPTSGSISTMKVYIDSKMVFQNGGGSLSLFEGGVANGTHHLVVNAWDDFGRLYQASENFSVTGNLPFSCPVTGVGVRICAPTTGSVVSQNLGFTAGFKGSTPIKFVRAYLGSADVFDFAPPTSGQTSVTVGAISAPVGTQTLTVVAWDTNNTVYKSSVSLKTYYEADCPPKGTTCNPGIYQSTPNDGEDVQSPFRVNASVQNNTASITAMKAYVDGVQAGASSGPTFDQPITAAKGTHILVIQAWDMAGKLYRLTENVNVQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.