Scaffold Ga0066412_1021917

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0066412_1021917

Scaffold Ga0066412_1021917

Overview

Basic Information
Taxon OID	3300004173 Open in IMG/M
Scaffold ID	Ga0066412_1021917 Open in IMG/M
Source Dataset Name	Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 16_LOW5
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	895
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Source Dataset Sampling Location
Location Name	USA: Lake Washington, Seattle, Washington
Coordinates	Lat. (^o)	48.3807	Long. (^o)	-122.1599	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055309	Metagenome	139	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066412_10219171	F055309	GGAG	MVTRSCTFLKKWCLLARDKLGLNLANPVAKAHLRQIKSVVGPLSDFYLLQYGNNVRLPLTVNPLQTLTLPRNQRINLQTRGAPKAV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.