NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066647_10372396

Scaffold Ga0066647_10372396


Overview

Basic Information
Taxon OID3300004186 Open in IMG/M
Scaffold IDGa0066647_10372396 Open in IMG/M
Source Dataset NameGroundwater microbial communities from aquifer - Crystal Geyser CG18_big_fil_WC_8/21/14_2.50
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)618
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets

Source Dataset Sampling Location
Location NameUSA: Utah: Grand County
CoordinatesLat. (o)38.9383Long. (o)-110.1342Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000320Metagenome / Metatranscriptome1306Y
F000449Metagenome / Metatranscriptome1126Y

Sequences

Protein IDFamilyRBSSequence
Ga0066647_103723961F000449N/AENKKASEEDTSSLDLDQEFELRTSAPREEMERYYARKKASLERKLRKINKKIKKNIYNPYINDDEKHKNALD*
Ga0066647_103723962F000320N/AMPSTKGNKVEVLGREILRKINQIGQKTYKLKKDVNGIGGLVLSRPGATMFVEGYKAELWKEASDDFSQQWKEIGVEKYVVECMVHLMYDLVLQEEIKRKGKIILNLKRRAITLAK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.