NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066650_10496904

Scaffold Ga0066650_10496904


Overview

Basic Information
Taxon OID3300004239 Open in IMG/M
Scaffold IDGa0066650_10496904 Open in IMG/M
Source Dataset NameGroundwater microbial communities from aquifer - Crystal Geyser CG23_combo_of_CG06-09_8/20/14_all
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)564
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets

Source Dataset Sampling Location
Location NameUSA: Utah: Grand County
CoordinatesLat. (o)38.9383Long. (o)-110.1342Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016919Metagenome243Y

Sequences

Protein IDFamilyRBSSequence
Ga0066650_104969041F016919N/AISKEKYHIEVRVATGKGFRLRLIDTQTKKGRKHRRGLDTLNEIKFAHSTVVNAVKEIFGGGEYKKVLVVWDVEDSRVIEQAKSIYGIDIWKISDIIGELMQKVKTKPYRNDVLRTIQLISQKAKHVSRPLKEFL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.