NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066605_10148755

Scaffold Ga0066605_10148755


Overview

Basic Information
Taxon OID3300004279 Open in IMG/M
Scaffold IDGa0066605_10148755 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)931
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameBritish Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002915Metagenome / Metatranscriptome521Y
F004166Metagenome / Metatranscriptome450N
F098743Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0066605_101487551F098743N/AMKYLILLCFIIAITTCAMAHDKSSEFYIPSESNAYQGRLIYDS
Ga0066605_101487552F002915AGGMKGLFLLSLIIPIIAQGKEVFTNEQGLKIEYVKPSVSCFYDKEAYEGYLNTCLMLPNYETCAQTKYENYICSDQNMIKQLEKKAKEAR*
Ga0066605_101487553F004166N/AFLVPLISCSDHQVNDSWGSYATNKETQKQEFWFTSYKTREECIEDMSWQLEGEDDPNKKRISNLHTKPYGCHFMSNNKWLSMYYYLVYKDEGLGCLWESSNPNVRIKYSVTLKTFVIAPEQGRCILGD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.