NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0065726_11638

Scaffold Ga0065726_11638


Overview

Basic Information
Taxon OID3300004369 Open in IMG/M
Scaffold IDGa0065726_11638 Open in IMG/M
Source Dataset NameSaline microbial communities from the South Caspian sea - cas-15
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)31889
Total Scaffold Genes38 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (21.05%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline → Saline Microbial Communities From The South Caspian Sea

Source Dataset Sampling Location
Location NameCaspian Sea
CoordinatesLat. (o)41.916215Long. (o)50.672019Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F093806Metagenome106N

Sequences

Protein IDFamilyRBSSequence
Ga0065726_1163835F093806N/AMFDIRWIQNESTVISRQLPEVLGCSEFAVSMAIKDLLYCIAYNEDSQLCNLDFFQPLHLEVRFEYWEESVIYSSLHQKAIFNQGSFVIGADVHSFYGFYTAHQVLFESMRFRERKMFRDGGPLYELFYWRFMSDQGMLVNMLFDREYSFRSYIGSFIEVKDDPTEYLDLQEELRKSITTKRFYAEQSQFFNVLASPIVGMLAYSKKHSRCAICDTKVEQESEYGYCLNCAKEFLLPFSEKTIGPIDYDGLRKSKLIDKNDFYSGNDYEYWITSNGELGYRDTNLPF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.