NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0065726_16520

Scaffold Ga0065726_16520


Overview

Basic Information
Taxon OID3300004369 Open in IMG/M
Scaffold IDGa0065726_16520 Open in IMG/M
Source Dataset NameSaline microbial communities from the South Caspian sea - cas-15
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12656
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (31.25%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline → Saline Microbial Communities From The South Caspian Sea

Source Dataset Sampling Location
Location NameCaspian Sea
CoordinatesLat. (o)41.916215Long. (o)50.672019Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017728Metagenome / Metatranscriptome239Y
F028945Metagenome / Metatranscriptome190Y

Sequences

Protein IDFamilyRBSSequence
Ga0065726_165201F017728N/AINQRRPERVAIKFPPMYYTTTTKDSVYYDIMRPVDDINVGDIIEMTRTGKEFLVESITPNKIILKECAKYVSFSRSALNERLKRNSAIHKSI*
Ga0065726_165205F028945N/AMKVRFLKSVSGNGFHYRKDAVVEIHSDEMLTDFLNAGFCEAIAESPKARAKKAVKKNTTKETR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.