NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0065861_1042198

Scaffold Ga0065861_1042198


Overview

Basic Information
Taxon OID3300004448 Open in IMG/M
Scaffold IDGa0065861_1042198 Open in IMG/M
Source Dataset NameMarine viral communities from Newfoundland, Canada BC-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterYale University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1458
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Viral Communities From Newfoundland, Canada

Source Dataset Sampling Location
Location NameNewfoundland, Canada
CoordinatesLat. (o)47.593411Long. (o)-52.885466Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003357Metagenome / Metatranscriptome492N
F028312Metagenome / Metatranscriptome192Y
F076488Metagenome / Metatranscriptome118N

Sequences

Protein IDFamilyRBSSequence
Ga0065861_10421982F028312N/AVTVAGWLVRINGKKYPRGHFDGDDTPDWTYRYTPGEGNTEAGKKIAIDRALGEARLTVLPSVL*
Ga0065861_10421984F076488AGGAGMRTEYDEVKEILIKHDVDLDGDIDYMMETIVYGEPLFQELFEYFIGDMPYDVAKGRADLMSDEWILDRVQALGLIKEEA*
Ga0065861_10421985F003357AGGAGGMKRNSWIVKQMFADAKNNLGWVFKGVLVAGGFVAGIKILTFFNMPKEIVFPVMWIAFIVLMAYKWYSMKYDWSKEDKAYDRASKKYTNKLKELK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.