Scaffold Ga0066222_1045965

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0066222_1045965

Scaffold Ga0066222_1045965

Overview

Basic Information
Taxon OID	3300004460 Open in IMG/M
Scaffold ID	Ga0066222_1045965 Open in IMG/M
Source Dataset Name	Marine viral communities from Newfoundland, Canada BC-1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Yale University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2335
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (83.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Viral Communities From Newfoundland, Canada

Source Dataset Sampling Location
Location Name	Newfoundland, Canada
Coordinates	Lat. (^o)	47.593411	Long. (^o)	-52.885466	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000324	Metagenome / Metatranscriptome	1299	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066222_10459654	F000324	AGG	MTERAHLAHAVTYDGASINVFHANKGEGIPKHSHVYSHLTICHAGSCVIRKEGIEKIIDKNTQPINLKADEWHEIEALEDGTVFVNVFAESKY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.