NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0062595_100013759

Scaffold Ga0062595_100013759


Overview

Basic Information
Taxon OID3300004479 Open in IMG/M
Scaffold IDGa0062595_100013759 Open in IMG/M
Source Dataset NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2790
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location
Location NameWisconsin, United States
CoordinatesLat. (o)43.56Long. (o)-89.32Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002508Metagenome / Metatranscriptome553Y
F006286Metagenome / Metatranscriptome377Y
F047286Metagenome150Y

Sequences

Protein IDFamilyRBSSequence
Ga0062595_1000137593F002508GGCGGMSNDDDKRPAFARRRNSEVSRNFHRLGLLVAALILAAGLLLMLKDALGLRLGDLIPADIPILAGGIAIGLTGIALASLAGYGVVRAIGWTIDRSI*
Ga0062595_1000137594F006286GGAGMSFNYLTNSSGFTRIAAYVGQMVDHAVGAQIEKISQNLHPDPATQCLNRPMDLSELMSRTIAP*
Ga0062595_1000137597F047286GGAGGMGTVTFLAPANPQWVSLELEMICVLRRLMGNDSPFGWCDFITLTEPRGPCAEFCDHFGPVVRLTRVDRRYEVTCLRTGALKRTTNLGSAAALIRARWSAGVHTHPQGSIRDHAS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.