Basic Information | |
---|---|
Taxon OID | 3300004556 Open in IMG/M |
Scaffold ID | Ga0066489_1012378 Open in IMG/M |
Source Dataset Name | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 1_LOW4 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 590 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Lake Washington, Seattle, Washington | |||||||
Coordinates | Lat. (o) | 48.3807 | Long. (o) | -122.1599 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F053640 | Metagenome / Metatranscriptome | 141 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0066489_10123782 | F053640 | N/A | PPLQAAQADERHISPVPLAGVVSGQFTHESGTERQGAIRNRVEPSQAHGRFRPVCRRSYPRGFWLLLRRPERSHGTRRANPAKRPRSPYE*GAQGNRDSGERADLAKSVKPPQWGGVKNHVTPLQKRKQP* |
⦗Top⦘ |