NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066491_1022330

Scaffold Ga0066491_1022330


Overview

Basic Information
Taxon OID3300004586 Open in IMG/M
Scaffold IDGa0066491_1022330 Open in IMG/M
Source Dataset NameFreshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 3_LOW4 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)517
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Source Dataset Sampling Location
Location NameUSA: Lake Washington, Seattle, Washington
CoordinatesLat. (o)48.3807Long. (o)-122.1599Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014145Metagenome / Metatranscriptome265Y

Sequences

Protein IDFamilyRBSSequence
Ga0066491_10223301F014145N/AGSLPACTASSTANKSAGRFASPLPVGRFLQPPDQCFLARRWPPLARNRSLVTAFRSPATATASRRPPFRGQSSQPATSLPSKFASVPVRPFGSTTASRFAPVAAVSLPLARCTSTTRFSLPRLRSPLPSGTFTSLGIKAFNRVCRLPVHLTNPPDFLSLPAARPDESWGCGS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.