Scaffold Ga0058865_1152593

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0058865_1152593

Scaffold Ga0058865_1152593

Overview

Basic Information
Taxon OID	3300004622 Open in IMG/M
Scaffold ID	Ga0058865_1152593 Open in IMG/M
Source Dataset Name	Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - TNR Reactor, Time C-32min-Anaerobic_ RNA (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	548
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa

Source Dataset Sampling Location
Location Name	Madison, Wisconsin, USA
Coordinates	Lat. (^o)	43.076217	Long. (^o)	-89.411742	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032160	Metagenome / Metatranscriptome	180	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0058865_11525931	F032160	N/A	EIVLQSKYEKTQLIMAQNTSENNLEVISMVIWLSTGNGKFFELHGSRETIKQILPQSSESAFRWGYYNSPADPDRQSYTQVLEAFLKAGFRIEGSSGAGSQGLLRTQYILVKRNA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.