Basic Information | |
---|---|
Taxon OID | 3300004629 Open in IMG/M |
Scaffold ID | Ga0008092_11290175 Open in IMG/M |
Source Dataset Name | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1094 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil → Tropical Rainforest Soil Microbial Communities From The Amazon Forest, Brazil, For Analyzing Deforestation At Different Spatial Scales |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Amazon Forest, Brazil | |||||||
Coordinates | Lat. (o) | -10.0 | Long. (o) | -62.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006901 | Metagenome / Metatranscriptome | 362 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0008092_112901752 | F006901 | GGGGG | MARLVFAIIVVAVLSLPFVAVSYNESSAQERATCSQARAHCGTQRVCQRRYEACMETGCWTVTLVRRCGYEKR* |
⦗Top⦘ |