NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0058899_10091769

Scaffold Ga0058899_10091769


Overview

Basic Information
Taxon OID3300004631 Open in IMG/M
Scaffold IDGa0058899_10091769 Open in IMG/M
Source Dataset NameForest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1699
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Source Dataset Sampling Location
Location NameHarvard Forest LTER, Petersham, MA, USA
CoordinatesLat. (o)42.531427Long. (o)-72.189946Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005065Metagenome / Metatranscriptome413Y
F014401Metagenome / Metatranscriptome263Y

Sequences

Protein IDFamilyRBSSequence
Ga0058899_100917692F005065GGAGGMMDANYISERLGSMRQEISDLRITTARYWSKDQHTALEKSAFALRKGRLLEIKREVSDMMKRCA*
Ga0058899_100917693F014401AGGAMNTGRVWLQLYKAALFDSDADKVSDRIAEAETALVVRARELFHAAGDNIEEEQAVDDAMYALHALRSALKYRPNKKNASQELAA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.