NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066395_10003021

Scaffold Ga0066395_10003021


Overview

Basic Information
Taxon OID3300004633 Open in IMG/M
Scaffold IDGa0066395_10003021 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5800
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (58.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama: Oeste
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014106Metagenome / Metatranscriptome265Y
F024457Metagenome / Metatranscriptome205Y
F105649Metagenome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0066395_100030213F014106AGGAGGMRTFILAWVIGLLGLIMIAGGIWGVIDLFRQEVRAPLKSYGVAVSMVCGGVAMLGMAQGLRLLLVLIVLAHH*
Ga0066395_100030215F105649N/AMSYSSFARTNVAHFGLLLIAAVILASCTTNRTDTPTAQAAPEPLTQSKAAEQCWMETEHGAKSLPLDKRSKVVDQCVKDKMSGAK*
Ga0066395_100030218F024457N/AMKTIRQSQLARAWSRRSRVGDIVIFDVLGAAPRGSGATEAAAREDVRRVAESLRALHEDFNGEAFLIVPG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.